PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf01083g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 336aa    MW: 36277.2 Da    PI: 7.4562
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf01083g00019.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-1299143347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
  Peaxi162Scf01083g00019.1  99 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 143
                               8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.93992148IPR017930Myb domain
SuperFamilySSF466896.96E-1794149IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-1995147IPR006447Myb domain, plants
SMARTSM007178.0E-1196146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-1196142IPR009057Homeodomain-like
CDDcd001672.65E-999144No hitNo description
PfamPF002491.1E-1099143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MTRRCSHCST NGHNSRTCPN RGVKLFGVRL TDGLIRKSAS MGNLTHFASS SSSGTQLVNH  60
NESPGDTPDH HVGASADGYA SEDFVAGSSS SRERKKGVPW TEEEHRMFLL GLQKLGKGDW  120
RGIARNYVIS RTPTQVASHA QKYFIRQSNM SRRKRRSSLF DIVADESGDT PMVSRDFLDD  180
PSQGEMQSNN PLPPAPAIDE ECESMGSAAS ANSNDGEHSV PKPESSQYPH PLVYPAYVAP  240
FFPVPYPCWP GYTAEPAKAE THEVLKPTAV HSKSPINVDE LVGMSKLSLG ESLGDAKPSS  300
LSLKLVEGSS RQSAFHANPS SSSSGMNSSH SPIHAV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankS747530.0S74753.1 mybSt1=Myb-related transcriptional activator [Solanum tuberosum=potatoes, leaf, mRNA, 1465 nt].
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783629.10.0PREDICTED: transcription factor MYB1R1 isoform X2
RefseqXP_016504132.10.0PREDICTED: transcription factor MYB1R1-like isoform X2
TrEMBLM1CHD30.0M1CHD3_SOLTU; Uncharacterized protein
TrEMBLA0A0V0IA260.0A0A0V0IA26_SOLCH; Putative MYBST1 protein-like
STRINGPGSC0003DMT4000674890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70622431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-134MYB_related family protein